PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G008700.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 800aa    MW: 87960.5 Da    PI: 4.8424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G008700.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.1e-194995148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Sobic.003G008700.3.p 49 KGNWTPEEDAILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 95
                          79******************************.************986 PP

2Myb_DNA-binding61.12.4e-19101147148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+W++eEde++v+ v+++G++ W++Ia+ ++ gR +kqc++rw+++l
  Sobic.003G008700.3.p 101 KGPWSKEEDEIIVQMVNKYGPKKWSAIAQALP-GRIGKQCRERWHNHL 147
                           79******************************.*************97 PP

3Myb_DNA-binding47.64e-15153195145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  Sobic.003G008700.3.p 153 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 195
                           579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6774495IPR017930Myb domain
SuperFamilySSF466895.18E-1947109IPR009057Homeodomain-like
SMARTSM007173.1E-174897IPR001005SANT/Myb domain
PfamPF002493.1E-164995IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2451107IPR009057Homeodomain-like
CDDcd001675.01E-155195No hitNo description
PROSITE profilePS5129431.63696151IPR017930Myb domain
SuperFamilySSF466891.69E-3198194IPR009057Homeodomain-like
SMARTSM007179.6E-19100149IPR001005SANT/Myb domain
CDDcd001671.29E-16103147No hitNo description
PfamPF139214.8E-18104164No hitNo description
Gene3DG3DSA:1.10.10.603.8E-27108150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-21151202IPR009057Homeodomain-like
SMARTSM007174.4E-14152200IPR001005SANT/Myb domain
PROSITE profilePS5129419.654152202IPR017930Myb domain
CDDcd001675.26E-11155195No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MPSGKAKAPK GGEDPGIPPV PCEGEISHEP QRQRSLNGRT TGPTRRSTKG NWTPEEDAIL  60
SRAVQTYQGK NWKKIAECFP DRTDVQCLHR WQKVLNPELV KGPWSKEEDE IIVQMVNKYG  120
PKKWSAIAQA LPGRIGKQCR ERWHNHLNPA INKEAWTQEE EITLIHAHRM YGNKWAELTK  180
FLPGRTDNAI KNHWNSSVKK KVDSYISSGL LSQVPCLPLI EYPAQCDSLS SMDQENNGDS  240
VCNAQNTSMA LSSDLQVNVD ANKREAQDSH SSLCQGACYP STEAVGSVLP DENHHVPSSF  300
SQRMDLQMDM DEGSGNSMFA DDQTLCSTSN QEKSMVPFVV AQEMPVSVLS GVSSAEQKLH  360
LISDAESLKS ELWKDVSLQT LISGVTVDAD ASRLNHPDSS KMDTNFLTQA YPLHTSNPSG  420
VMETVYEPMP SETISPSFIC SDGLSVAPEN RSEPREMPDC EAQMATSSNI FCDGDQSAIP  480
GSSDDRPEAF TMTESITNCG GQQSTDAEEP MATTAKEQLS KDIETVPDEK KGEGALFYEP  540
PRFPGLDVPF ISCDLVTSAD LQEFSPLGIR QWMRSTMNVP TPLRLWGSPT HDESPDLLKS  600
AAESFPCTPS IMKKRQRGLL SPTPDKRIEK KSGIAKGVTD ISYMITTTCS MNATNDGDIV  660
TESVVCAEQP SFKHLDKKLE FSNINMENSD GASKQAKDPQ NAGNKRLVEE SSPNVANPNT  720
DLQDNIQPVR ILVEHSSNNL IAADHGAKPS CKEVISSKSK PTELLVEKSS PCINADYEYV  780
NLCQKRFGIS FCMEVSLVY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-68492026159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-68492026159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0875060.0BT087506.1 Zea mays full-length cDNA clone ZM_BFb0098J09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310566.10.0uncharacterized protein LOC100502241
RefseqXP_008673352.10.0PREDICTED: uncharacterized protein LOC100502241 isoform X1
TrEMBLC5XJP50.0C5XJP5_SORBI; Putative uncharacterized protein Sb03g000930
STRINGSb03g000930.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-105myb domain protein 3r-4